PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009121155.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Nin-like
Protein Properties Length: 899aa    MW: 99735.4 Da    PI: 4.7022
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009121155.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK887.9e-28613663252
          RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     ek+i l++l++yF++++kdAAk++gvc+T+LKriCR++GI RWP+Rkik++
  XP_009121155.1 613 EKTIGLDVLRQYFAGSLKDAAKSIGVCPTTLKRICRHHGITRWPSRKIKKV 663
                     799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.836602683IPR003035RWP-RK domain
PfamPF020426.7E-24616663IPR003035RWP-RK domain
SuperFamilySSF542777.57E-24791886No hitNo description
Gene3DG3DSA:3.10.20.2401.5E-23799882No hitNo description
SMARTSM006663.0E-26801884IPR000270PB1 domain
PROSITE profilePS5174526.065801884IPR000270PB1 domain
PfamPF005644.9E-16802883IPR000270PB1 domain
CDDcd064074.96E-43802883No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 899 aa     Download sequence    Send to blast
MGLDMEDDGG SDGGEGNGGF SPNSSFGAFP ETAMDLDFMD ELLFDGCWLE TTDSKSLKET  60
EEAASDSTAM NANSSFLCFG ENPSQDNFSN EETERMNQEG FDQAEKFLLD EAEVGRSWWI  120
APRTREDPCS SVKERLLRAI SGLEEAVPDK DFLVQIWVPF QQEGKNFLTT LAQPHLFNQK  180
YSSLAKYRHV SETYNFPADE GSTEGGLPGR VFLQKFPEWT PDVRFFRSDE YPRIKEAQKC  240
DVRGSLALPV FERCSGTCLG VVEVVTTTQK MNYRPELENI CKALEAVDLR SSSNLKPPNN  300
ESLQVYNDFY YAALPEISDF LASVCRRYDL PLALSWAPCA QQGKGGSRHS DENFSQCVST  360
IDSACFVLDE ESKYFLEACS EHHLLQGEGI VGKAFKATKL CFVPEVTTFS KTNYPLAHHA  420
KISGLHAALA VPLKSKCNGL VEFVLEFFFP KGCLDTEAKQ EMLKSLSATL QQDFRSSNLV  480
IDKDLELEVV LPVREDMVLS ENPLTGAETA EALREIHLLQ ESSWISHMIK ANEKGKDVSL  540
SWEYQNEDPK DEFKLSPGWD NSQLDPAPNN IPSEAEQFQQ GSTPGLRVDA GPSTESASTG  600
GRRPGEKRRT KTEKTIGLDV LRQYFAGSLK DAAKSIGVCP TTLKRICRHH GITRWPSRKI  660
KKVGHSLKKL QLVMDSVQGA QGSIPLDSFY TSFPELSSPN ISSNGSSLKN NEQLHHYNVP  720
IENGGPGEDK PAPRSPSSSC SGSNTNTPNA DGVVKEAHSE AELQNGNQEE TKCLARTQSH  780
NIFKEPPLPG SSKMSFRDGG GIKVKATFGE AIIRFTLLPS WGYTELQQEI TRRFNIVDVS  840
WFDLKYLDDD EEWVLLTCEA DLEECIDIYR SSQSQTIKIS LHDPFQVKLG GSFGSSGPS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009121154.10.0PREDICTED: protein NLP1 isoform X1
RefseqXP_009121155.10.0PREDICTED: protein NLP1 isoform X1
RefseqXP_009121156.10.0PREDICTED: protein NLP1 isoform X1
RefseqXP_013666605.10.0PREDICTED: protein NLP1-like isoform X1
RefseqXP_013666606.10.0PREDICTED: protein NLP1-like isoform X1
RefseqXP_013666607.10.0PREDICTED: protein NLP1-like isoform X1
SwissprotQ8H1110.0NLP1_ARATH; Protein NLP1
TrEMBLA0A078H3G70.0A0A078H3G7_BRANA; BnaA07g03130D protein
STRINGBra002025.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17150.10.0Nin-like family protein